Transfer operation
of a domain: bestremotestartcommediajsnetsoltrademarkphpdwspeedagencykrgnu5bbsboardphpbotablefreewrid571961.ua
Domain name transfer is possible only if you are the current owner of the domain name bestremotestartcommediajsnetsoltrademarkphpdwspeedagencykrgnu5bbsboardphpbotablefreewrid571961.ua.in the zone UA with a free renewal for 1 year.
Start the transfer
Peculiarity of domain transfer in the zone UA
Registrar identifier, legal name | UA.THEHOST-LLC, Legal name - TheHost LLC |
Using the transfer code | Yes |
Transfer is paid | Yes |
Transfer extension | Yes |
Transfer completion period | up to 5 days |
Transfer code validity period | 30 days |
Answers to common questions
What is the final cost of the domain transfer "bestremotestartcommediajsnetsoltrademarkphpdwspeedagencykrgnu5bbsboardphpbotablefreewrid571961.ua"?
Domain name transfer "bestremotestartcommediajsnetsoltrademarkphpdwspeedagencykrgnu5bbsboardphpbotablefreewrid571961.ua" will cost 2299 53.34 57.7
Can I transfer someone else's/non-my domain name?
Technically, this is possible if you have all the data necessary for the transfer and the domain owner delegated this to you.
Will my domain expire if I transfer it before the expiration period?
The validity period, of course, will not be lost. It will increase by +1 year from the expiration date at the time of the transfer. Thus, for you, as for our client, the transfer of a domain name will be tantamount to renewing the domain name at our prices.
Is the domain name transfer/transfer procedure safe?
Yes, it's safe. There is no danger in this procedure. The main thing is not to disclose the transfer/transfer code to third parties. It can only be communicated to us as the receiving registrar.
Will my website/mail work when transferring a domain?
Yes. If the site worked before the start of the transfer procedure, it will continue to work.
How can I transfer my domain to you?
You can perform the transfer following the instructions - How to transfer a domain name to us for service.
Transfer operation
of a domain: bestremotestartcommediajsnetsoltrademarkphpdwspeedagencykrgnu5bbsboardphpbotablefreewrid571961.ua
Domain name transfer is possible only if you are the current owner of the domain name bestremotestartcommediajsnetsoltrademarkphpdwspeedagencykrgnu5bbsboardphpbotablefreewrid571961.ua.in the zone UA with a free renewal for 1 year.
Start the transfer