Domain transfer

Examples of queries: thehost.ua , thehost.net.ua
WWW.

Transfer operation

of a domain:  bestremotestartcommediajsnetsoltrademarkphpdwspeedagencykrgnu5bbsboardphpbotablefreewrid571961.ua

Domain name transfer is possible only if you are the current owner of the domain name bestremotestartcommediajsnetsoltrademarkphpdwspeedagencykrgnu5bbsboardphpbotablefreewrid571961.ua.
2299 53.34 57.7
The price of transfer
in the zone UA with a free renewal for 1 year.

Start the transfer

Peculiarity of domain transfer in the zone UA

Answers to common questions

What is the final cost of the domain transfer "bestremotestartcommediajsnetsoltrademarkphpdwspeedagencykrgnu5bbsboardphpbotablefreewrid571961.ua"?

Domain name transfer "bestremotestartcommediajsnetsoltrademarkphpdwspeedagencykrgnu5bbsboardphpbotablefreewrid571961.ua" will cost 2299 53.34 57.7

Can I transfer someone else's/non-my domain name?

Technically, this is possible if you have all the data necessary for the transfer and the domain owner delegated this to you.

Will my domain expire if I transfer it before the expiration period?

The validity period, of course, will not be lost. It will increase by +1 year from the expiration date at the time of the transfer. Thus, for you, as for our client, the transfer of a domain name will be tantamount to renewing the domain name at our prices.

Is the domain name transfer/transfer procedure safe?

Yes, it's safe. There is no danger in this procedure. The main thing is not to disclose the transfer/transfer code to third parties. It can only be communicated to us as the receiving registrar.

Will my website/mail work when transferring a domain?

Yes. If the site worked before the start of the transfer procedure, it will continue to work.

How can I transfer my domain to you?

You can perform the transfer following the instructions - How to transfer a domain name to us for service.

Transfer operation

of a domain:  bestremotestartcommediajsnetsoltrademarkphpdwspeedagencykrgnu5bbsboardphpbotablefreewrid571961.ua

Domain name transfer is possible only if you are the current owner of the domain name bestremotestartcommediajsnetsoltrademarkphpdwspeedagencykrgnu5bbsboardphpbotablefreewrid571961.ua.
2299 53.34 57.7
The price of transfer
in the zone UA with a free renewal for 1 year.

Start the transfer


// FaceBook Pixel